Icon representing a puzzle

2435: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,530
  2. Avatar for Go Science 2. Go Science 68 pts. 11,324
  3. Avatar for Contenders 3. Contenders 44 pts. 11,101
  4. Avatar for Australia 4. Australia 27 pts. 11,100
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,008
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,925
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 10,923
  8. Avatar for VeFold 8. VeFold 3 pts. 10,733
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,611
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 10,559

  1. Avatar for ProfVince 41. ProfVince Lv 1 4 pts. 10,269
  2. Avatar for Vinara 42. Vinara Lv 1 4 pts. 10,217
  3. Avatar for JackONeill12 43. JackONeill12 Lv 1 3 pts. 10,210
  4. Avatar for VU21BTEN0100033 44. VU21BTEN0100033 Lv 1 3 pts. 10,169
  5. Avatar for pfirth 45. pfirth Lv 1 3 pts. 10,160
  6. Avatar for zbp 46. zbp Lv 1 2 pts. 10,152
  7. Avatar for VU21BTEN0100050 47. VU21BTEN0100050 Lv 1 2 pts. 10,139
  8. Avatar for Karlheinz 48. Karlheinz Lv 1 2 pts. 10,138
  9. Avatar for Kvaksius 49. Kvaksius Lv 1 2 pts. 10,134
  10. Avatar for phi16 50. phi16 Lv 1 2 pts. 10,092

Comments