Icon representing a puzzle

2435: Revisiting Puzzle 148: Rosetta Decoy 11

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein is a component of the major histocompatibility complex (MHC) which is essential to a functioning immune system. The starting structure is a Rosetta model. This protein contains two cysteine residues that are oxidized to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
IQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLLKNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,530
  2. Avatar for Go Science 2. Go Science 68 pts. 11,324
  3. Avatar for Contenders 3. Contenders 44 pts. 11,101
  4. Avatar for Australia 4. Australia 27 pts. 11,100
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,008
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,925
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 10,923
  8. Avatar for VeFold 8. VeFold 3 pts. 10,733
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,611
  10. Avatar for Kotocycle 10. Kotocycle 1 pt. 10,559

  1. Avatar for Alistair69 51. Alistair69 Lv 1 1 pt. 10,082
  2. Avatar for Trajan464 52. Trajan464 Lv 1 1 pt. 10,075
  3. Avatar for Merf 53. Merf Lv 1 1 pt. 10,055
  4. Avatar for BarrySampson 54. BarrySampson Lv 1 1 pt. 10,048
  5. Avatar for Mohoernchen 55. Mohoernchen Lv 1 1 pt. 9,991
  6. Avatar for DScott 56. DScott Lv 1 1 pt. 9,988
  7. Avatar for Dr.Sillem 57. Dr.Sillem Lv 1 1 pt. 9,956
  8. Avatar for Jenot96 58. Jenot96 Lv 1 1 pt. 9,932
  9. Avatar for Arne Heessels 59. Arne Heessels Lv 1 1 pt. 9,927
  10. Avatar for abiogenesis 60. abiogenesis Lv 1 1 pt. 9,904

Comments