Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for WSU Bioc Spring 2016 11. WSU Bioc Spring 2016 1 pt. 10,222
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 10,079

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,679
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 95 pts. 11,624
  3. Avatar for grogar7 3. grogar7 Lv 1 90 pts. 11,621
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 85 pts. 11,578
  5. Avatar for akaaka 5. akaaka Lv 1 80 pts. 11,529
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 76 pts. 11,504
  7. Avatar for guineapig 7. guineapig Lv 1 72 pts. 11,458
  8. Avatar for Serca 8. Serca Lv 1 68 pts. 11,447
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 64 pts. 11,428
  10. Avatar for MicElephant 10. MicElephant Lv 1 60 pts. 11,398

Comments