Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,683
  2. Avatar for Go Science 2. Go Science 63 pts. 11,624
  3. Avatar for Contenders 3. Contenders 37 pts. 11,458
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 11,428
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 11,343
  6. Avatar for Australia 6. Australia 5 pts. 11,304
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 11,162
  8. Avatar for VeFold 8. VeFold 1 pt. 11,064
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,879
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,474
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,679
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 95 pts. 11,624
  3. Avatar for grogar7 3. grogar7 Lv 1 90 pts. 11,621
  4. Avatar for Sandrix72 4. Sandrix72 Lv 1 85 pts. 11,578
  5. Avatar for akaaka 5. akaaka Lv 1 80 pts. 11,529
  6. Avatar for Punzi Baker 3 6. Punzi Baker 3 Lv 1 76 pts. 11,504
  7. Avatar for guineapig 7. guineapig Lv 1 72 pts. 11,458
  8. Avatar for Serca 8. Serca Lv 1 68 pts. 11,447
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 64 pts. 11,428
  10. Avatar for MicElephant 10. MicElephant Lv 1 60 pts. 11,398

Comments