Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for WSU Bioc Spring 2016 11. WSU Bioc Spring 2016 1 pt. 10,222
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 10,079

  1. Avatar for BackBuffer 11. BackBuffer Lv 1 56 pts. 11,390
  2. Avatar for g_b 12. g_b Lv 1 53 pts. 11,387
  3. Avatar for BootsMcGraw 13. BootsMcGraw Lv 1 50 pts. 11,385
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 47 pts. 11,379
  5. Avatar for orily1337 15. orily1337 Lv 1 44 pts. 11,343
  6. Avatar for Marvelz 16. Marvelz Lv 1 41 pts. 11,333
  7. Avatar for blazegeek 17. blazegeek Lv 1 39 pts. 11,311
  8. Avatar for AlkiP0Ps 18. AlkiP0Ps Lv 1 36 pts. 11,304
  9. Avatar for Galaxie 19. Galaxie Lv 1 34 pts. 11,277
  10. Avatar for fpc 20. fpc Lv 1 32 pts. 11,273

Comments