Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for WSU Bioc Spring 2016 11. WSU Bioc Spring 2016 1 pt. 10,222
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 10,079

  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 29 pts. 11,242
  2. Avatar for ichwilldiesennamen 22. ichwilldiesennamen Lv 1 27 pts. 11,239
  3. Avatar for jausmh 23. jausmh Lv 1 26 pts. 11,236
  4. Avatar for NinjaGreg 24. NinjaGreg Lv 1 24 pts. 11,235
  5. Avatar for silent gene 25. silent gene Lv 1 22 pts. 11,229
  6. Avatar for BarrySampson 26. BarrySampson Lv 1 21 pts. 11,201
  7. Avatar for Steven Pletsch 27. Steven Pletsch Lv 1 19 pts. 11,201
  8. Avatar for alcor29 28. alcor29 Lv 1 18 pts. 11,171
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 16 pts. 11,162
  10. Avatar for phi16 30. phi16 Lv 1 15 pts. 11,077

Comments