Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for WSU Bioc Spring 2016 11. WSU Bioc Spring 2016 1 pt. 10,222
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 10,079

  1. Avatar for VU21BTEN0100050 41. VU21BTEN0100050 Lv 1 6 pts. 10,925
  2. Avatar for Komeiji_Koishi 42. Komeiji_Koishi Lv 1 6 pts. 10,918
  3. Avatar for zbp 43. zbp Lv 1 5 pts. 10,880
  4. Avatar for ShadowTactics 44. ShadowTactics Lv 1 5 pts. 10,879
  5. Avatar for jamiexq 45. jamiexq Lv 1 4 pts. 10,854
  6. Avatar for Larini 46. Larini Lv 1 4 pts. 10,852
  7. Avatar for mibrammall 47. mibrammall Lv 1 3 pts. 10,839
  8. Avatar for apetrides 48. apetrides Lv 1 3 pts. 10,768
  9. Avatar for Vinara 49. Vinara Lv 1 3 pts. 10,758
  10. Avatar for Arne Heessels 50. Arne Heessels Lv 1 3 pts. 10,753

Comments