Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for WSU Bioc Spring 2016 11. WSU Bioc Spring 2016 1 pt. 10,222
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 10,079

  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 2 pts. 10,737
  2. Avatar for Jenot96 52. Jenot96 Lv 1 2 pts. 10,680
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 2 pts. 10,623
  4. Avatar for pfirth 54. pfirth Lv 1 2 pts. 10,599
  5. Avatar for Merf 55. Merf Lv 1 2 pts. 10,586
  6. Avatar for carxo 56. carxo Lv 1 1 pt. 10,548
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 10,503
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 10,481
  9. Avatar for Simek 59. Simek Lv 1 1 pt. 10,474
  10. Avatar for Mohoernchen 60. Mohoernchen Lv 1 1 pt. 10,434

Comments