Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for WSU Bioc Spring 2016 11. WSU Bioc Spring 2016 1 pt. 10,222
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 10,079
  1. Avatar for crosenquist99 61. crosenquist99 Lv 1 1 pt. 10,406
  2. Avatar for Bupinoot 62. Bupinoot Lv 1 1 pt. 10,362
  3. Avatar for Huckel4plus2 63. Huckel4plus2 Lv 1 1 pt. 10,348
  4. Avatar for evifnoskcaj 64. evifnoskcaj Lv 1 1 pt. 10,348
  5. Avatar for Autumobile 65. Autumobile Lv 1 1 pt. 10,321
  6. Avatar for breadthethird 66. breadthethird Lv 1 1 pt. 10,319
  7. Avatar for jonathanjojo87 67. jonathanjojo87 Lv 1 1 pt. 10,318
  8. Avatar for pruneau_44 68. pruneau_44 Lv 1 1 pt. 10,312
  9. Avatar for Plumcrazycat 69. Plumcrazycat Lv 1 1 pt. 10,299
  10. Avatar for naq 70. naq Lv 1 1 pt. 10,276

Comments