Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for WSU Bioc Spring 2016 11. WSU Bioc Spring 2016 1 pt. 10,222
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 10,079

  1. Avatar for jcnichols 71. jcnichols Lv 1 1 pt. 10,222
  2. Avatar for furi0us 72. furi0us Lv 1 1 pt. 10,216
  3. Avatar for Bruno Bean 73. Bruno Bean Lv 1 1 pt. 10,193
  4. Avatar for Svexel 74. Svexel Lv 1 1 pt. 10,154
  5. Avatar for jdmclure 75. jdmclure Lv 1 1 pt. 10,146
  6. Avatar for Neel_devani1710 76. Neel_devani1710 Lv 1 1 pt. 10,131
  7. Avatar for way to smart 77. way to smart Lv 1 1 pt. 10,079
  8. Avatar for Pandalligator 78. Pandalligator Lv 1 1 pt. 9,707
  9. Avatar for Quinten 79. Quinten Lv 1 1 pt. 9,608
  10. Avatar for xiaoyang666 80. xiaoyang666 Lv 1 1 pt. 9,302

Comments