Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since about 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,683
  2. Avatar for Go Science 2. Go Science 63 pts. 11,624
  3. Avatar for Contenders 3. Contenders 37 pts. 11,458
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 11,428
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 11,343
  6. Avatar for Australia 6. Australia 5 pts. 11,304
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 11,162
  8. Avatar for VeFold 8. VeFold 1 pt. 11,064
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,879
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,474

  1. Avatar for spvincent 91. spvincent Lv 1 1 pt. 9,086
  2. Avatar for AlexBg 92. AlexBg Lv 1 1 pt. 9,086

Comments