Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,683
  2. Avatar for Go Science 2. Go Science 63 pts. 11,624
  3. Avatar for Contenders 3. Contenders 37 pts. 11,458
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 11,428
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 11,343
  6. Avatar for Australia 6. Australia 5 pts. 11,304
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 11,162
  8. Avatar for VeFold 8. VeFold 1 pt. 11,064
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,879
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,474

  1. Avatar for VU21BTEN0100050 41. VU21BTEN0100050 Lv 1 6 pts. 10,925
  2. Avatar for Komeiji_Koishi 42. Komeiji_Koishi Lv 1 6 pts. 10,918
  3. Avatar for zbp 43. zbp Lv 1 5 pts. 10,880
  4. Avatar for ShadowTactics 44. ShadowTactics Lv 1 5 pts. 10,879
  5. Avatar for jamiexq 45. jamiexq Lv 1 4 pts. 10,854
  6. Avatar for Larini 46. Larini Lv 1 4 pts. 10,852
  7. Avatar for mibrammall 47. mibrammall Lv 1 3 pts. 10,839
  8. Avatar for apetrides 48. apetrides Lv 1 3 pts. 10,768
  9. Avatar for Vinara 49. Vinara Lv 1 3 pts. 10,758
  10. Avatar for Arne Heessels 50. Arne Heessels Lv 1 3 pts. 10,753

Comments