Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,683
  2. Avatar for Go Science 2. Go Science 63 pts. 11,624
  3. Avatar for Contenders 3. Contenders 37 pts. 11,458
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 11,428
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 11,343
  6. Avatar for Australia 6. Australia 5 pts. 11,304
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 11,162
  8. Avatar for VeFold 8. VeFold 1 pt. 11,064
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,879
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,474
  1. Avatar for latin krepin 31. latin krepin Lv 1 14 pts. 11,069
  2. Avatar for Hillbillie 32. Hillbillie Lv 1 13 pts. 11,064
  3. Avatar for heather-1 33. heather-1 Lv 1 12 pts. 11,044
  4. Avatar for georg137 34. georg137 Lv 1 11 pts. 11,027
  5. Avatar for maithra 35. maithra Lv 1 10 pts. 11,007
  6. Avatar for rosie4loop 36. rosie4loop Lv 1 9 pts. 10,982
  7. Avatar for NPrincipi 37. NPrincipi Lv 1 9 pts. 10,981
  8. Avatar for ProfVince 38. ProfVince Lv 1 8 pts. 10,973
  9. Avatar for Trajan464 39. Trajan464 Lv 1 7 pts. 10,939
  10. Avatar for kitsoune 40. kitsoune Lv 1 7 pts. 10,938

Comments