Icon representing a puzzle

2438: Revisiting Puzzle 150: Rosetta Decoy 12

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (without disulfides bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,683
  2. Avatar for Go Science 2. Go Science 63 pts. 11,624
  3. Avatar for Contenders 3. Contenders 37 pts. 11,458
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 11,428
  5. Avatar for Marvin's bunch 5. Marvin's bunch 11 pts. 11,343
  6. Avatar for Australia 6. Australia 5 pts. 11,304
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 11,162
  8. Avatar for VeFold 8. VeFold 1 pt. 11,064
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,879
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,474
  1. Avatar for Evelyn Bryan 81. Evelyn Bryan Lv 1 1 pt. 9,276
  2. Avatar for 22012491 82. 22012491 Lv 1 1 pt. 9,150
  3. Avatar for 0947664 83. 0947664 Lv 1 1 pt. 9,137
  4. Avatar for POLICARPIO 84. POLICARPIO Lv 1 1 pt. 9,086
  5. Avatar for rschen 85. rschen Lv 1 1 pt. 9,086
  6. Avatar for man_the_stan 86. man_the_stan Lv 1 1 pt. 9,086
  7. Avatar for Eldoblador 87. Eldoblador Lv 1 1 pt. 9,086
  8. Avatar for haleyg 88. haleyg Lv 1 1 pt. 9,086
  9. Avatar for DanielCentellas 89. DanielCentellas Lv 1 1 pt. 9,086
  10. Avatar for Dhanashree Bhate 90. Dhanashree Bhate Lv 1 1 pt. 9,086

Comments