Icon representing a puzzle

2441: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,767
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,665
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 10,637
  4. Avatar for SHELL 14. SHELL 1 pt. 9,521
  5. Avatar for CS 234 15. CS 234 1 pt. 9,117
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,295
  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 52 pts. 11,530
  2. Avatar for Marvelz 12. Marvelz Lv 1 48 pts. 11,522
  3. Avatar for MicElephant 13. MicElephant Lv 1 45 pts. 11,484
  4. Avatar for guineapig 14. guineapig Lv 1 42 pts. 11,476
  5. Avatar for Punzi Baker 3 15. Punzi Baker 3 Lv 1 39 pts. 11,472
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 36 pts. 11,469
  7. Avatar for blazegeek 17. blazegeek Lv 1 33 pts. 11,463
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 31 pts. 11,450
  9. Avatar for AlkiP0Ps 19. AlkiP0Ps Lv 1 28 pts. 11,376
  10. Avatar for g_b 20. g_b Lv 1 26 pts. 11,353

Comments