2441: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 2 years ago

Summary

• Created: February 29, 2024
• Expires: April 17, 2024 at 23:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

• Sequence: GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

• 1. Anthropic Dreams 100 pts. 11,991
• 2. Go Science 71 pts. 11,722
• 3. Marvin's bunch 49 pts. 11,543
• 4. Contenders 33 pts. 11,537
• 5. FamilyBarmettler 22 pts. 11,469
• 6. Australia 14 pts. 11,376
• 7. L'Alliance Francophone 8 pts. 11,273
• 8. Russian team 5 pts. 11,023
• 9. VeFold 3 pts. 11,018
• 10. Gargleblasters 2 pts. 11,018

Top soloists

• 1. LociOiling 100 pts. 11,990
• 2. Serca 94 pts. 11,722
• 3. BackBuffer 89 pts. 11,697
• 4. Sandrix72 83 pts. 11,688
• 5. akaaka 78 pts. 11,591
• 6. NinjaGreg 73 pts. 11,588
• 7. ichwilldiesennamen 68 pts. 11,572
• 8. grogar7 64 pts. 11,548
• 9. orily1337 60 pts. 11,543
• 10. Bletchley Park 56 pts. 11,537

Comments

[Serca]

https://www.rcsb.org/3d-view/1DZO/1

[LociOiling]

you be pilin: https://foldit.fandom.com/wiki/Revisiting_puzzle/153:_Rosetta_Decoy_13