Icon representing a puzzle

2441: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,767
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,665
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 10,637
  4. Avatar for SHELL 14. SHELL 1 pt. 9,521
  5. Avatar for CS 234 15. CS 234 1 pt. 9,117
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,295
  1. Avatar for ShadowTactics 41. ShadowTactics Lv 1 4 pts. 10,767
  2. Avatar for Steven Pletsch 42. Steven Pletsch Lv 1 3 pts. 10,750
  3. Avatar for phi16 43. phi16 Lv 1 3 pts. 10,742
  4. Avatar for Trajan464 44. Trajan464 Lv 1 3 pts. 10,737
  5. Avatar for Larini 45. Larini Lv 1 2 pts. 10,701
  6. Avatar for Deleted player 46. Deleted player 2 pts. 10,665
  7. Avatar for kitsoune 47. kitsoune Lv 1 2 pts. 10,642
  8. Avatar for Ikuso 48. Ikuso Lv 1 2 pts. 10,637
  9. Avatar for zbp 49. zbp Lv 1 2 pts. 10,516
  10. Avatar for mengzach 50. mengzach Lv 1 1 pt. 10,509

Comments