Icon representing a puzzle

2441: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,767
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,665
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 10,637
  4. Avatar for SHELL 14. SHELL 1 pt. 9,521
  5. Avatar for CS 234 15. CS 234 1 pt. 9,117
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,295

  1. Avatar for Dr.Sillem 51. Dr.Sillem Lv 1 1 pt. 10,482
  2. Avatar for SuperEnzyme 52. SuperEnzyme Lv 1 1 pt. 10,452
  3. Avatar for carxo 53. carxo Lv 1 1 pt. 10,347
  4. Avatar for pfirth 54. pfirth Lv 1 1 pt. 10,309
  5. Avatar for hada 55. hada Lv 1 1 pt. 10,308
  6. Avatar for man_the_stan 56. man_the_stan Lv 1 1 pt. 10,273
  7. Avatar for JackONeill12 57. JackONeill12 Lv 1 1 pt. 10,206
  8. Avatar for Mohoernchen 58. Mohoernchen Lv 1 1 pt. 10,173
  9. Avatar for Arne Heessels 59. Arne Heessels Lv 1 1 pt. 10,111
  10. Avatar for DScott 60. DScott Lv 1 1 pt. 10,095

Comments