Icon representing a puzzle

2441: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,767
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,665
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 10,637
  4. Avatar for SHELL 14. SHELL 1 pt. 9,521
  5. Avatar for CS 234 15. CS 234 1 pt. 9,117
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,295

  1. Avatar for pizpot 61. pizpot Lv 1 1 pt. 10,092
  2. Avatar for breadthethird 62. breadthethird Lv 1 1 pt. 10,084
  3. Avatar for Seobi 63. Seobi Lv 1 1 pt. 9,987
  4. Avatar for abiogenesis 64. abiogenesis Lv 1 1 pt. 9,986
  5. Avatar for Jenot96 65. Jenot96 Lv 1 1 pt. 9,981
  6. Avatar for rinze 66. rinze Lv 1 1 pt. 9,975
  7. Avatar for pruneau_44 67. pruneau_44 Lv 1 1 pt. 9,897
  8. Avatar for Autumobile 68. Autumobile Lv 1 1 pt. 9,809
  9. Avatar for yahia 69. yahia Lv 1 1 pt. 9,692
  10. Avatar for Swapper242 70. Swapper242 Lv 1 1 pt. 9,626

Comments