Icon representing a puzzle

2441: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 10,767
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 1 pt. 10,665
  3. Avatar for Kotocycle 13. Kotocycle 1 pt. 10,637
  4. Avatar for SHELL 14. SHELL 1 pt. 9,521
  5. Avatar for CS 234 15. CS 234 1 pt. 9,117
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 8,295
  1. Avatar for furi0us 71. furi0us Lv 1 1 pt. 9,615
  2. Avatar for U202342273 72. U202342273 Lv 1 1 pt. 9,521
  3. Avatar for Elicitd 73. Elicitd Lv 1 1 pt. 9,209
  4. Avatar for nis.pra.cs234 74. nis.pra.cs234 Lv 1 1 pt. 9,117
  5. Avatar for Seld 75. Seld Lv 1 1 pt. 9,052
  6. Avatar for Ry 76. Ry Lv 1 1 pt. 9,010
  7. Avatar for Bluebox130 77. Bluebox130 Lv 1 1 pt. 8,360
  8. Avatar for Valeriya D 78. Valeriya D Lv 1 1 pt. 8,301
  9. Avatar for rmoretti 79. rmoretti Lv 1 1 pt. 8,295
  10. Avatar for stimpy81 80. stimpy81 Lv 1 1 pt. 8,295

Comments