Icon representing a puzzle

2441: Revisiting Puzzle 153: Rosetta Decoy 13

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This pilin protein allows the P. aeruginosa bacterium to adhere to human cells, sometimes resulting in infection. The starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
GTEFARSEGASALASVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTIALKPDPADGTADITLTFTMGGAGPKNKGKIITLTRTAADGLWKCTSDQDEQFIPKGCSR

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,991
  2. Avatar for Go Science 2. Go Science 71 pts. 11,722
  3. Avatar for Marvin's bunch 3. Marvin's bunch 49 pts. 11,543
  4. Avatar for Contenders 4. Contenders 33 pts. 11,537
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 22 pts. 11,469
  6. Avatar for Australia 6. Australia 14 pts. 11,376
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 11,273
  8. Avatar for Russian team 8. Russian team 5 pts. 11,023
  9. Avatar for VeFold 9. VeFold 3 pts. 11,018
  10. Avatar for Gargleblasters 10. Gargleblasters 2 pts. 11,018

  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 24 pts. 11,323
  2. Avatar for Galaxie 22. Galaxie Lv 1 22 pts. 11,313
  3. Avatar for drjr 23. drjr Lv 1 21 pts. 11,300
  4. Avatar for silent gene 24. silent gene Lv 1 19 pts. 11,290
  5. Avatar for fpc 25. fpc Lv 1 17 pts. 11,287
  6. Avatar for christioanchauvin 26. christioanchauvin Lv 1 16 pts. 11,273
  7. Avatar for latin krepin 27. latin krepin Lv 1 15 pts. 11,175
  8. Avatar for fusilli 28. fusilli Lv 1 13 pts. 11,153
  9. Avatar for alcor29 29. alcor29 Lv 1 12 pts. 11,088
  10. Avatar for georg137 30. georg137 Lv 1 11 pts. 11,056

Comments