Icon representing a puzzle

2444: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,028
  2. Avatar for Go Science 2. Go Science 56 pts. 11,915
  3. Avatar for Contenders 3. Contenders 29 pts. 11,715
  4. Avatar for Marvin's bunch 4. Marvin's bunch 14 pts. 11,303
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 6 pts. 11,259
  6. Avatar for Australia 6. Australia 2 pts. 11,249
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 1 pt. 11,129
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 11,089
  9. Avatar for VeFold 9. VeFold 1 pt. 10,797
  10. Avatar for G10 Life Science 10. G10 Life Science 1 pt. 8,139
  1. Avatar for BackBuffer 11. BackBuffer Lv 1 50 pts. 11,437
  2. Avatar for blazegeek 12. blazegeek Lv 1 46 pts. 11,425
  3. Avatar for Punzi Baker 3 13. Punzi Baker 3 Lv 1 43 pts. 11,347
  4. Avatar for guineapig 14. guineapig Lv 1 40 pts. 11,306
  5. Avatar for fpc 15. fpc Lv 1 37 pts. 11,303
  6. Avatar for gmn 16. gmn Lv 1 34 pts. 11,301
  7. Avatar for WBarme1234 17. WBarme1234 Lv 1 31 pts. 11,259
  8. Avatar for AlkiP0Ps 18. AlkiP0Ps Lv 1 29 pts. 11,249
  9. Avatar for BootsMcGraw 19. BootsMcGraw Lv 1 26 pts. 11,236
  10. Avatar for silent gene 20. silent gene Lv 1 24 pts. 11,230

Comments