Icon representing a puzzle

2444: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,028
  2. Avatar for Go Science 2. Go Science 56 pts. 11,915
  3. Avatar for Contenders 3. Contenders 29 pts. 11,715
  4. Avatar for Marvin's bunch 4. Marvin's bunch 14 pts. 11,303
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 6 pts. 11,259
  6. Avatar for Australia 6. Australia 2 pts. 11,249
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 1 pt. 11,129
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 11,089
  9. Avatar for VeFold 9. VeFold 1 pt. 10,797
  10. Avatar for G10 Life Science 10. G10 Life Science 1 pt. 8,139
  1. Avatar for Bletchley Park 21. Bletchley Park Lv 1 22 pts. 11,219
  2. Avatar for Galaxie 22. Galaxie Lv 1 20 pts. 11,212
  3. Avatar for phi16 23. phi16 Lv 1 19 pts. 11,190
  4. Avatar for NPrincipi 24. NPrincipi Lv 1 17 pts. 11,177
  5. Avatar for christioanchauvin 25. christioanchauvin Lv 1 15 pts. 11,129
  6. Avatar for latin krepin 26. latin krepin Lv 1 14 pts. 11,128
  7. Avatar for heather-1 27. heather-1 Lv 1 13 pts. 11,096
  8. Avatar for drjr 28. drjr Lv 1 12 pts. 11,096
  9. Avatar for ShadowTactics 29. ShadowTactics Lv 1 11 pts. 11,089
  10. Avatar for fusilli 30. fusilli Lv 1 10 pts. 11,065

Comments