Icon representing a puzzle

2444: Revisiting Puzzle 157: Rosetta Decoy 14

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is part of a T-cell receptor that recognizes pathogens in the body; the starting structure is a Rosetta model. This protein contains two cysteine residues which oxidize to form one disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
EAAVTQSPRNKVAVTGEKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGNTEKGDIPDGYKASRPSQEQFSLILESATPSQTSVYFCASGGGGTLYFGAGTRLSVL

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,028
  2. Avatar for Go Science 2. Go Science 56 pts. 11,915
  3. Avatar for Contenders 3. Contenders 29 pts. 11,715
  4. Avatar for Marvin's bunch 4. Marvin's bunch 14 pts. 11,303
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 6 pts. 11,259
  6. Avatar for Australia 6. Australia 2 pts. 11,249
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 1 pt. 11,129
  8. Avatar for BOINC@Poland 8. BOINC@Poland 1 pt. 11,089
  9. Avatar for VeFold 9. VeFold 1 pt. 10,797
  10. Avatar for G10 Life Science 10. G10 Life Science 1 pt. 8,139
  1. Avatar for Seobi 61. Seobi Lv 1 1 pt. 9,950
  2. Avatar for mengzach 62. mengzach Lv 1 1 pt. 9,937
  3. Avatar for Jenot96 63. Jenot96 Lv 1 1 pt. 9,915
  4. Avatar for pruneau_44 64. pruneau_44 Lv 1 1 pt. 9,827
  5. Avatar for GeorgeTheFurryFrog 65. GeorgeTheFurryFrog Lv 1 1 pt. 9,802
  6. Avatar for Deleted player 66. Deleted player 1 pt. 9,757
  7. Avatar for rcs43 67. rcs43 Lv 1 1 pt. 9,732
  8. Avatar for wallet 68. wallet Lv 1 1 pt. 9,726
  9. Avatar for Valeriya D 69. Valeriya D Lv 1 1 pt. 9,477
  10. Avatar for emilyfillbrook 70. emilyfillbrook Lv 1 1 pt. 9,219

Comments