Icon representing a puzzle

2447: Revisiting Puzzle 165: Rosetta Model 15

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,492
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,427
  3. Avatar for BIOF215 13. BIOF215 1 pt. 10,203
  4. Avatar for Creating Heroes 2.0 14. Creating Heroes 2.0 1 pt. 9,639
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 52 pts. 11,359
  2. Avatar for NinjaGreg 12. NinjaGreg Lv 1 49 pts. 11,346
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 45 pts. 11,334
  4. Avatar for akaaka 14. akaaka Lv 1 42 pts. 11,327
  5. Avatar for MicElephant 15. MicElephant Lv 1 39 pts. 11,320
  6. Avatar for BackBuffer 16. BackBuffer Lv 1 36 pts. 11,318
  7. Avatar for georg137 17. georg137 Lv 1 34 pts. 11,273
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 31 pts. 11,264
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 29 pts. 11,210
  10. Avatar for vs 20. vs Lv 1 27 pts. 11,208

Comments