Icon representing a puzzle

2447: Revisiting Puzzle 165: Rosetta Model 15

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 10,492
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 10,427
  3. Avatar for BIOF215 13. BIOF215 1 pt. 10,203
  4. Avatar for Creating Heroes 2.0 14. Creating Heroes 2.0 1 pt. 9,639
  1. Avatar for SuperEnzyme 41. SuperEnzyme Lv 1 4 pts. 10,748
  2. Avatar for ichwilldiesennamen 42. ichwilldiesennamen Lv 1 3 pts. 10,727
  3. Avatar for Gerom 43. Gerom Lv 1 3 pts. 10,714
  4. Avatar for Vinara 44. Vinara Lv 1 3 pts. 10,674
  5. Avatar for maithra 45. maithra Lv 1 2 pts. 10,641
  6. Avatar for Larini 46. Larini Lv 1 2 pts. 10,638
  7. Avatar for kitsoune 47. kitsoune Lv 1 2 pts. 10,593
  8. Avatar for alyssa_d_V2.0 48. alyssa_d_V2.0 Lv 1 2 pts. 10,492
  9. Avatar for Alistair69 49. Alistair69 Lv 1 2 pts. 10,471
  10. Avatar for Trajan464 50. Trajan464 Lv 1 1 pt. 10,468

Comments