Icon representing a puzzle

2447: Revisiting Puzzle 165: Rosetta Model 15

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,027
  2. Avatar for Go Science 2. Go Science 68 pts. 11,883
  3. Avatar for Contenders 3. Contenders 44 pts. 11,381
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,182
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,153
  7. Avatar for VeFold 7. VeFold 5 pts. 10,958
  8. Avatar for Australia 8. Australia 3 pts. 10,900
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,845
  10. Avatar for Russian team 10. Russian team 1 pt. 10,714
  1. Avatar for christioanchauvin 21. christioanchauvin Lv 1 25 pts. 11,186
  2. Avatar for gmn 22. gmn Lv 1 23 pts. 11,183
  3. Avatar for fpc 23. fpc Lv 1 21 pts. 11,182
  4. Avatar for Punzi Baker 3 24. Punzi Baker 3 Lv 1 19 pts. 11,177
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 18 pts. 11,153
  6. Avatar for BarrySampson 26. BarrySampson Lv 1 16 pts. 11,116
  7. Avatar for silent gene 27. silent gene Lv 1 15 pts. 11,113
  8. Avatar for Aubade01 28. Aubade01 Lv 1 14 pts. 11,097
  9. Avatar for latin krepin 29. latin krepin Lv 1 12 pts. 11,062
  10. Avatar for alcor29 30. alcor29 Lv 1 11 pts. 11,060

Comments