Icon representing a puzzle

2447: Revisiting Puzzle 165: Rosetta Model 15

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,027
  2. Avatar for Go Science 2. Go Science 68 pts. 11,883
  3. Avatar for Contenders 3. Contenders 44 pts. 11,381
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,182
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,153
  7. Avatar for VeFold 7. VeFold 5 pts. 10,958
  8. Avatar for Australia 8. Australia 3 pts. 10,900
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,845
  10. Avatar for Russian team 10. Russian team 1 pt. 10,714
  1. Avatar for fusilli 31. fusilli Lv 1 10 pts. 11,022
  2. Avatar for pizpot 32. pizpot Lv 1 9 pts. 10,958
  3. Avatar for AlkiP0Ps 33. AlkiP0Ps Lv 1 9 pts. 10,900
  4. Avatar for heather-1 34. heather-1 Lv 1 8 pts. 10,877
  5. Avatar for rosie4loop 35. rosie4loop Lv 1 7 pts. 10,869
  6. Avatar for Simek 36. Simek Lv 1 6 pts. 10,845
  7. Avatar for Hillbillie 37. Hillbillie Lv 1 6 pts. 10,832
  8. Avatar for roarshock 38. roarshock Lv 1 5 pts. 10,825
  9. Avatar for phi16 39. phi16 Lv 1 5 pts. 10,812
  10. Avatar for Merf 40. Merf Lv 1 4 pts. 10,764

Comments