Icon representing a puzzle

2447: Revisiting Puzzle 165: Rosetta Model 15

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
February 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to maintain the reduction potential of the cell. The starting structure is a Rosetta model. This protein contains four cysteine residues, but only two of them oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with problems that are still scientifically relevant.

Sequence
MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKSMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,027
  2. Avatar for Go Science 2. Go Science 68 pts. 11,883
  3. Avatar for Contenders 3. Contenders 44 pts. 11,381
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 16 pts. 11,182
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,153
  7. Avatar for VeFold 7. VeFold 5 pts. 10,958
  8. Avatar for Australia 8. Australia 3 pts. 10,900
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,845
  10. Avatar for Russian team 10. Russian team 1 pt. 10,714
  1. Avatar for GeorgeTheFurryFrog 71. GeorgeTheFurryFrog Lv 1 1 pt. 9,878
  2. Avatar for mart0258 72. mart0258 Lv 1 1 pt. 9,810
  3. Avatar for Swapper242 73. Swapper242 Lv 1 1 pt. 9,757
  4. Avatar for K.Jahanfar 74. K.Jahanfar Lv 1 1 pt. 9,754
  5. Avatar for furi0us 75. furi0us Lv 1 1 pt. 9,750
  6. Avatar for Arlind1 76. Arlind1 Lv 1 1 pt. 9,739
  7. Avatar for zulkeflee_CH2 77. zulkeflee_CH2 Lv 1 1 pt. 9,639
  8. Avatar for TheGUmmer 78. TheGUmmer Lv 1 1 pt. 9,500
  9. Avatar for SlaughterCat 79. SlaughterCat Lv 1 1 pt. 8,986
  10. Avatar for alpkyssoman 80. alpkyssoman Lv 1 1 pt. 8,481

Comments