Placeholder image of a protein
Icon representing a puzzle

2430:Electron Density Reconstruction 82

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GAMMSRLKTAVYDYLNDVDITECTEMDLLCQLSNCCDFINETYAKNYDTLYDIMERDILSYNIVNIKNTLTFALRDASPSVKLATLTLLASVIKKLNKIQHTDAAMFSEVIDGIVAEEQQVIGFIQKKCKYNTTYYNVRSGGCK

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 1 pt. 41,033
  2. Avatar for Team China 12. Team China 1 pt. 39,409
  3. Avatar for bio 13. bio 1 pt. 25,562

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 42,140
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 94 pts. 42,125
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 42,124
  4. Avatar for grogar7 4. grogar7 Lv 1 81 pts. 42,109
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 75 pts. 42,070
  6. Avatar for Sandrix72 6. Sandrix72 Lv 1 70 pts. 42,060
  7. Avatar for BackBuffer 7. BackBuffer Lv 1 64 pts. 42,034
  8. Avatar for gmn 8. gmn Lv 1 60 pts. 41,998
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 55 pts. 41,997
  10. Avatar for georg137 10. georg137 Lv 1 51 pts. 41,986

Comments