Placeholder image of a protein
Icon representing a puzzle

2430:Electron Density Reconstruction 82

Closed since about 2 years ago

Novice Overall Prediction Electron Density

Summary


Created
March 07, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. There's two chains here of the same thing, but both are missing a few residues that are slightly different.

Sequence
GAMMSRLKTAVYDYLNDVDITECTEMDLLCQLSNCCDFINETYAKNYDTLYDIMERDILSYNIVNIKNTLTFALRDASPSVKLATLTLLASVIKKLNKIQHTDAAMFSEVIDGIVAEEQQVIGFIQKKCKYNTTYYNVRSGGCK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 42,141
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 42,125
  3. Avatar for Go Science 3. Go Science 41 pts. 42,070
  4. Avatar for Contenders 4. Contenders 24 pts. 41,986
  5. Avatar for Marvin's bunch 5. Marvin's bunch 14 pts. 41,812
  6. Avatar for Australia 6. Australia 7 pts. 41,766
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 41,741
  8. Avatar for Gargleblasters 8. Gargleblasters 2 pts. 41,494
  9. Avatar for VeFold 9. VeFold 1 pt. 41,292
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 41,233

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 42,140
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 94 pts. 42,125
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 42,124
  4. Avatar for grogar7 4. grogar7 Lv 1 81 pts. 42,109
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 75 pts. 42,070
  6. Avatar for Sandrix72 6. Sandrix72 Lv 1 70 pts. 42,060
  7. Avatar for BackBuffer 7. BackBuffer Lv 1 64 pts. 42,034
  8. Avatar for gmn 8. gmn Lv 1 60 pts. 41,998
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 55 pts. 41,997
  10. Avatar for georg137 10. georg137 Lv 1 51 pts. 41,986

Comments