Placeholder image of a protein
Icon representing a puzzle

2445: Electron Density Reconstruction 87

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 16, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN TGTTTTTTATAAGA ATCTTATAAAAAAC

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,535
  2. Avatar for Go Science 2. Go Science 52 pts. 20,531
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 20,499
  4. Avatar for Contenders 4. Contenders 10 pts. 20,493
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 20,350
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 1 pt. 20,337
  7. Avatar for Australia 7. Australia 1 pt. 20,091
  8. Avatar for VeFold 8. VeFold 1 pt. 19,900
  9. Avatar for chemiosmotic 9. chemiosmotic 1 pt. 19,194

  1. Avatar for maithra 31. maithra Lv 1 4 pts. 20,013
  2. Avatar for latin krepin 32. latin krepin Lv 1 3 pts. 19,989
  3. Avatar for BarrySampson 33. BarrySampson Lv 1 3 pts. 19,929
  4. Avatar for Dr.Sillem 34. Dr.Sillem Lv 1 3 pts. 19,900
  5. Avatar for fusilli 35. fusilli Lv 1 2 pts. 19,867
  6. Avatar for Trajan464 36. Trajan464 Lv 1 2 pts. 19,773
  7. Avatar for zbp 37. zbp Lv 1 2 pts. 19,715
  8. Avatar for Larini 38. Larini Lv 1 1 pt. 19,679
  9. Avatar for Bautho 39. Bautho Lv 1 1 pt. 19,674
  10. Avatar for manu8170 40. manu8170 Lv 1 1 pt. 19,653

Comments