Placeholder image of a protein
Icon representing a puzzle

2445: Electron Density Reconstruction 87

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 16, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN TGTTTTTTATAAGA ATCTTATAAAAAAC

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 20,535
  2. Avatar for Go Science 2. Go Science 52 pts. 20,531
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 24 pts. 20,499
  4. Avatar for Contenders 4. Contenders 10 pts. 20,493
  5. Avatar for Marvin's bunch 5. Marvin's bunch 4 pts. 20,350
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 1 pt. 20,337
  7. Avatar for Australia 7. Australia 1 pt. 20,091
  8. Avatar for VeFold 8. VeFold 1 pt. 19,900
  9. Avatar for chemiosmotic 9. chemiosmotic 1 pt. 19,194
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 20,535
  2. Avatar for Sandrix72 2. Sandrix72 Lv 1 93 pts. 20,530
  3. Avatar for christioanchauvin 3. christioanchauvin Lv 1 85 pts. 20,499
  4. Avatar for MicElephant 4. MicElephant Lv 1 78 pts. 20,493
  5. Avatar for toshiue 5. toshiue Lv 1 72 pts. 20,479
  6. Avatar for g_b 6. g_b Lv 1 66 pts. 20,476
  7. Avatar for guineapig 7. guineapig Lv 1 60 pts. 20,468
  8. Avatar for grogar7 8. grogar7 Lv 1 55 pts. 20,465
  9. Avatar for gmn 9. gmn Lv 1 50 pts. 20,463
  10. Avatar for Punzi Baker 3 10. Punzi Baker 3 Lv 1 46 pts. 20,461

Comments