Placeholder image of a protein
Icon representing a puzzle

2448: Electron Density Reconstruction 88

Closed since almost 2 years ago

Novice Overall Electron Density

Summary

Created
April 18, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This is part 2 of the Watson-Crick vs Hoogsteen question posed in Reconstruction Puzzle 84, now starting with a Watson-Crick base pair. Also, a reminder of the useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP*GP*A)-3'

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 55,235
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 54,498
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 54,493
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 54,353
  5. Avatar for Contenders 5. Contenders 14 pts. 54,242
  6. Avatar for Australia 6. Australia 7 pts. 53,096
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 52,533
  8. Avatar for VeFold 8. VeFold 2 pts. 51,839
  9. Avatar for BIOF215 9. BIOF215 1 pt. 51,237
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 49,958
  1. Avatar for Arne Heessels 51. Arne Heessels Lv 1 1 pt. 49,684
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 49,673
  3. Avatar for DScott 53. DScott Lv 1 1 pt. 49,646
  4. Avatar for Swapper242 54. Swapper242 Lv 1 1 pt. 49,641
  5. Avatar for racheli 55. racheli Lv 1 1 pt. 49,614
  6. Avatar for rinze 56. rinze Lv 1 1 pt. 49,545
  7. Avatar for Merf 57. Merf Lv 1 1 pt. 49,525
  8. Avatar for aMusicalCoder001 58. aMusicalCoder001 Lv 1 1 pt. 49,328
  9. Avatar for Arlind1 59. Arlind1 Lv 1 1 pt. 48,310
  10. Avatar for mart0258 60. mart0258 Lv 1 1 pt. 48,294

Comments

grogar7 Lv 1

Frequent errors running trim operation on this puzzle. No DNA segments in selection