Placeholder image of a protein
Icon representing a puzzle

2448: Electron Density Reconstruction 88

Closed since almost 2 years ago

Novice Overall Electron Density

Summary


Created
April 18, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This is part 2 of the Watson-Crick vs Hoogsteen question posed in Reconstruction Puzzle 84, now starting with a Watson-Crick base pair. Also, a reminder of the useful note from Bletchley Park for working with DNA: DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFR 5'-D(*CP*TP*TP*GP*GP*TP*TP*AP*AP*TP*AP*AP*TP*TP*CP*AP*CP*CP*AP*GP*A)-3'

Top groups


  1. Avatar for Go Science 100 pts. 55,235
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 54,498
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 41 pts. 54,493
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 54,353
  5. Avatar for Contenders 5. Contenders 14 pts. 54,242
  6. Avatar for Australia 6. Australia 7 pts. 53,096
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 52,533
  8. Avatar for VeFold 8. VeFold 2 pts. 51,839
  9. Avatar for BIOF215 9. BIOF215 1 pt. 51,237
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 49,958

  1. Avatar for jackguy 61. jackguy Lv 1 1 pt. 47,735
  2. Avatar for ShadowTactics 62. ShadowTactics Lv 1 1 pt. 35,774
  3. Avatar for rmoretti 63. rmoretti Lv 1 1 pt. 24,284
  4. Avatar for furi0us 64. furi0us Lv 1 1 pt. 20,137
  5. Avatar for deadpan 65. deadpan Lv 1 1 pt. 19,194
  6. Avatar for phi16 66. phi16 Lv 1 1 pt. 19,184
  7. Avatar for MTonsy 67. MTonsy Lv 1 1 pt. 19,184
  8. Avatar for spvincent 68. spvincent Lv 1 1 pt. 19,184
  9. Avatar for Mathew 69. Mathew Lv 1 1 pt. 19,184

Comments


grogar7 Lv 1

Frequent errors running trim operation on this puzzle. No DNA segments in selection