Placeholder image of a protein
Icon representing a puzzle

2451: Electron Density Reconstruction 89

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK. TTATCCCCTTAAGGGGATATATATATAT. ATATCCCCTTAAGGGGATAA

Top groups

  1. Avatar for Villanova ChE 11. Villanova ChE 1 pt. 0
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0
  1. Avatar for vs 21. vs Lv 1 19 pts. 41,995
  2. Avatar for fpc 22. fpc Lv 1 17 pts. 41,944
  3. Avatar for akaaka 23. akaaka Lv 1 15 pts. 41,845
  4. Avatar for silent gene 24. silent gene Lv 1 14 pts. 41,826
  5. Avatar for NPrincipi 25. NPrincipi Lv 1 12 pts. 41,740
  6. Avatar for alcor29 26. alcor29 Lv 1 11 pts. 41,721
  7. Avatar for latin krepin 27. latin krepin Lv 1 10 pts. 41,710
  8. Avatar for Idiotboy 28. Idiotboy Lv 1 9 pts. 41,698
  9. Avatar for nicobul 29. nicobul Lv 1 8 pts. 41,381
  10. Avatar for grogar7 30. grogar7 Lv 1 7 pts. 41,281

Comments