Placeholder image of a protein
Icon representing a puzzle

2451: Electron Density Reconstruction 89

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK. TTATCCCCTTAAGGGGATATATATATAT. ATATCCCCTTAAGGGGATAA

Top groups

  1. Avatar for Villanova ChE 11. Villanova ChE 1 pt. 0
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0
  1. Avatar for georg137 31. georg137 Lv 1 6 pts. 41,037
  2. Avatar for Artoria2e5 32. Artoria2e5 Lv 1 6 pts. 40,960
  3. Avatar for kitsoune 33. kitsoune Lv 1 5 pts. 40,884
  4. Avatar for Gerom 34. Gerom Lv 1 4 pts. 40,676
  5. Avatar for BarrySampson 35. BarrySampson Lv 1 4 pts. 40,658
  6. Avatar for rosie4loop 36. rosie4loop Lv 1 3 pts. 40,647
  7. Avatar for fusilli 37. fusilli Lv 1 3 pts. 40,508
  8. Avatar for vybi 38. vybi Lv 1 3 pts. 40,352
  9. Avatar for Trajan464 39. Trajan464 Lv 1 2 pts. 40,293
  10. Avatar for Alistair69 40. Alistair69 Lv 1 2 pts. 40,235

Comments