Placeholder image of a protein
Icon representing a puzzle

2451: Electron Density Reconstruction 89

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK. TTATCCCCTTAAGGGGATATATATATAT. ATATCCCCTTAAGGGGATAA

Top groups

  1. Avatar for Villanova ChE 11. Villanova ChE 1 pt. 0
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0
  1. Avatar for Larini 41. Larini Lv 1 2 pts. 40,127
  2. Avatar for Dr.Sillem 42. Dr.Sillem Lv 1 2 pts. 39,995
  3. Avatar for nancya 43. nancya Lv 1 1 pt. 39,728
  4. Avatar for zbp 44. zbp Lv 1 1 pt. 39,545
  5. Avatar for hada 45. hada Lv 1 1 pt. 39,514
  6. Avatar for mengzach 46. mengzach Lv 1 1 pt. 39,379
  7. Avatar for abiogenesis 47. abiogenesis Lv 1 1 pt. 39,135
  8. Avatar for Deleted player 48. Deleted player 1 pt. 38,721
  9. Avatar for Merf 49. Merf Lv 1 1 pt. 38,675
  10. Avatar for DScott 50. DScott Lv 1 1 pt. 38,648

Comments