Placeholder image of a protein
Icon representing a puzzle

2451: Electron Density Reconstruction 89

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
April 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK. TTATCCCCTTAAGGGGATATATATATAT. ATATCCCCTTAAGGGGATAA

Top groups


  1. Avatar for Villanova ChE 11. Villanova ChE 1 pt. 0
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0

  1. Avatar for Jenot96 51. Jenot96 Lv 1 1 pt. 38,480
  2. Avatar for rinze 52. rinze Lv 1 1 pt. 38,277
  3. Avatar for JackONeill12 53. JackONeill12 Lv 1 1 pt. 38,250
  4. Avatar for osc 54. osc Lv 1 1 pt. 38,172
  5. Avatar for carxo 55. carxo Lv 1 1 pt. 38,099
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 38,019
  7. Avatar for mart0258 57. mart0258 Lv 1 1 pt. 38,006
  8. Avatar for furi0us 58. furi0us Lv 1 1 pt. 37,902
  9. Avatar for murasame 59. murasame Lv 1 1 pt. 37,679
  10. Avatar for Swapper242 60. Swapper242 Lv 1 1 pt. 37,302

Comments