Placeholder image of a protein
Icon representing a puzzle

2451: Electron Density Reconstruction 89

Closed since almost 2 years ago

Novice Overall Prediction Electron Density

Summary

Created
April 25, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCDAK. TTATCCCCTTAAGGGGATATATATATAT. ATATCCCCTTAAGGGGATAA

Top groups

  1. Avatar for Villanova ChE 11. Villanova ChE 1 pt. 0
  2. Avatar for Foldit Staff 12. Foldit Staff 1 pt. 0
  1. Avatar for ssoparkar 61. ssoparkar Lv 1 1 pt. 36,650
  2. Avatar for maithra 62. maithra Lv 1 1 pt. 32,423
  3. Avatar for AlphaFold2 63. AlphaFold2 Lv 1 1 pt. 27,628
  4. Avatar for Serca 64. Serca Lv 1 1 pt. 0
  5. Avatar for Mathew 65. Mathew Lv 1 1 pt. 0
  6. Avatar for andy123456789 66. andy123456789 Lv 1 1 pt. 0
  7. Avatar for PROTEINA_79 67. PROTEINA_79 Lv 1 1 pt. 0
  8. Avatar for Smoffa 68. Smoffa Lv 1 1 pt. 0
  9. Avatar for hookedwarm 69. hookedwarm Lv 1 1 pt. 0
  10. Avatar for rmoretti 70. rmoretti Lv 1 1 pt. 0

Comments