Icon representing a puzzle

2453: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
May 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,609
  2. Avatar for Go Science 2. Go Science 60 pts. 11,605
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 11,359
  4. Avatar for Australia 4. Australia 17 pts. 11,257
  5. Avatar for Contenders 5. Contenders 8 pts. 11,139
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 4 pts. 11,043
  7. Avatar for VeFold 7. VeFold 2 pts. 10,976
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,938
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,594
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 10,082
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,609
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 11,600
  3. Avatar for Sandrix72 3. Sandrix72 Lv 1 88 pts. 11,561
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 82 pts. 11,472
  5. Avatar for grogar7 5. grogar7 Lv 1 77 pts. 11,435
  6. Avatar for blazegeek 6. blazegeek Lv 1 71 pts. 11,380
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 66 pts. 11,359
  8. Avatar for gmn 8. gmn Lv 1 62 pts. 11,316
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 57 pts. 11,292
  10. Avatar for Punzi Baker 3 10. Punzi Baker 3 Lv 1 53 pts. 11,275

Comments