Icon representing a puzzle

2453: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
May 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 0

  1. Avatar for alcor29 31. alcor29 Lv 1 8 pts. 10,698
  2. Avatar for Larini 32. Larini Lv 1 7 pts. 10,674
  3. Avatar for manu8170 33. manu8170 Lv 1 7 pts. 10,610
  4. Avatar for firejuggler 34. firejuggler Lv 1 6 pts. 10,594
  5. Avatar for rosie4loop 35. rosie4loop Lv 1 5 pts. 10,593
  6. Avatar for ucad 36. ucad Lv 1 5 pts. 10,590
  7. Avatar for BarrySampson 37. BarrySampson Lv 1 4 pts. 10,566
  8. Avatar for Merf 38. Merf Lv 1 4 pts. 10,565
  9. Avatar for hada 39. hada Lv 1 3 pts. 10,539
  10. Avatar for abiogenesis 40. abiogenesis Lv 1 3 pts. 10,537

Comments