Icon representing a puzzle

2453: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
May 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 0

  1. Avatar for silent gene 41. silent gene Lv 1 3 pts. 10,533
  2. Avatar for Dr.Sillem 42. Dr.Sillem Lv 1 2 pts. 10,516
  3. Avatar for nancya 43. nancya Lv 1 2 pts. 10,451
  4. Avatar for Deleted player 44. Deleted player 2 pts. 10,442
  5. Avatar for Zleeb 45. Zleeb Lv 1 2 pts. 10,393
  6. Avatar for pfirth 46. pfirth Lv 1 2 pts. 10,350
  7. Avatar for zbp 47. zbp Lv 1 1 pt. 10,343
  8. Avatar for DScott 48. DScott Lv 1 1 pt. 10,336
  9. Avatar for Trajan464 49. Trajan464 Lv 1 1 pt. 10,329
  10. Avatar for kitsoune 50. kitsoune Lv 1 1 pt. 10,328

Comments