Icon representing a puzzle

2453: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
May 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 0
  1. Avatar for mengzach 51. mengzach Lv 1 1 pt. 10,254
  2. Avatar for Arne Heessels 52. Arne Heessels Lv 1 1 pt. 10,234
  3. Avatar for jamiexq 53. jamiexq Lv 1 1 pt. 10,156
  4. Avatar for carxo 54. carxo Lv 1 1 pt. 10,110
  5. Avatar for rinze 55. rinze Lv 1 1 pt. 10,106
  6. Avatar for maithra 56. maithra Lv 1 1 pt. 10,097
  7. Avatar for Antibrad 57. Antibrad Lv 1 1 pt. 10,082
  8. Avatar for Mohoernchen 58. Mohoernchen Lv 1 1 pt. 10,049
  9. Avatar for FoldingCarl49 59. FoldingCarl49 Lv 1 1 pt. 10,015
  10. Avatar for TheGUmmer 60. TheGUmmer Lv 1 1 pt. 9,933

Comments