Icon representing a puzzle

2453: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
May 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 0
  1. Avatar for osc 61. osc Lv 1 1 pt. 9,906
  2. Avatar for frostschutz 62. frostschutz Lv 1 1 pt. 9,903
  3. Avatar for Kimdonghyeon 63. Kimdonghyeon Lv 1 1 pt. 9,899
  4. Avatar for Th1sN@me!sN0tAPun 64. Th1sN@me!sN0tAPun Lv 1 1 pt. 9,875
  5. Avatar for asilva22 65. asilva22 Lv 1 1 pt. 9,840
  6. Avatar for DipsyDoodle2016 66. DipsyDoodle2016 Lv 1 1 pt. 9,829
  7. Avatar for furi0us 67. furi0us Lv 1 1 pt. 9,736
  8. Avatar for Jenot96 68. Jenot96 Lv 1 1 pt. 9,729
  9. Avatar for julesdoingwork 69. julesdoingwork Lv 1 1 pt. 9,566
  10. Avatar for Vinara 70. Vinara Lv 1 1 pt. 9,513

Comments