Icon representing a puzzle

2453: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 2 years ago

Novice Overall Prediction

Summary

Created
May 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Foldit Staff 11. Foldit Staff 1 pt. 0
  1. Avatar for Marvelz 71. Marvelz Lv 1 1 pt. 9,454
  2. Avatar for hookedwarm 72. hookedwarm Lv 1 1 pt. 9,003
  3. Avatar for SFTGFOP1 73. SFTGFOP1 Lv 1 1 pt. 0
  4. Avatar for Hillbillie 74. Hillbillie Lv 1 1 pt. 0
  5. Avatar for rmoretti 75. rmoretti Lv 1 1 pt. 0
  6. Avatar for spvincent 76. spvincent Lv 1 1 pt. 0

Comments