2453: Revisiting Puzzle 52: Bacteria Energy
Closed since almost 2 years ago
Novice Novice Overall Overall Prediction PredictionSummary
- Created
- May 01, 2024
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
- Sequence
- KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA
Top groups
-
100 pts. 11,609
-
-
-
-
-
-
-
-
-