Icon representing a puzzle

2453: Revisiting Puzzle 52: Bacteria Energy

Closed since almost 2 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
May 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,609
  2. Avatar for Go Science 2. Go Science 60 pts. 11,605
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 11,359
  4. Avatar for Australia 4. Australia 17 pts. 11,257
  5. Avatar for Contenders 5. Contenders 8 pts. 11,139
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 4 pts. 11,043
  7. Avatar for VeFold 7. VeFold 2 pts. 10,976
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,938
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,594
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 10,082

  1. Avatar for AlkiP0Ps 11. AlkiP0Ps Lv 1 49 pts. 11,257
  2. Avatar for Steven Pletsch 12. Steven Pletsch Lv 1 46 pts. 11,246
  3. Avatar for NinjaGreg 13. NinjaGreg Lv 1 42 pts. 11,239
  4. Avatar for Idiotboy 14. Idiotboy Lv 1 39 pts. 11,170
  5. Avatar for vs 15. vs Lv 1 36 pts. 11,169
  6. Avatar for Bletchley Park 16. Bletchley Park Lv 1 33 pts. 11,139
  7. Avatar for akaaka 17. akaaka Lv 1 31 pts. 11,109
  8. Avatar for latin krepin 18. latin krepin Lv 1 28 pts. 11,099
  9. Avatar for MicElephant 19. MicElephant Lv 1 26 pts. 11,062
  10. Avatar for WBarme1234 20. WBarme1234 Lv 1 24 pts. 11,043

Comments