Icon representing a puzzle

2453: Revisiting Puzzle 52: Bacteria Energy

Closed since about 2 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,609
  2. Avatar for Go Science 2. Go Science 60 pts. 11,605
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 11,359
  4. Avatar for Australia 4. Australia 17 pts. 11,257
  5. Avatar for Contenders 5. Contenders 8 pts. 11,139
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 4 pts. 11,043
  7. Avatar for VeFold 7. VeFold 2 pts. 10,976
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,938
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,594
  10. Avatar for Beta Folders 10. Beta Folders 1 pt. 10,082

  1. Avatar for BackBuffer 21. BackBuffer Lv 1 22 pts. 11,025
  2. Avatar for ProfVince 22. ProfVince Lv 1 20 pts. 10,979
  3. Avatar for AlphaFold2 23. AlphaFold2 Lv 1 18 pts. 10,976
  4. Avatar for g_b 24. g_b Lv 1 17 pts. 10,973
  5. Avatar for Galaxie 25. Galaxie Lv 1 15 pts. 10,947
  6. Avatar for fpc 26. fpc Lv 1 14 pts. 10,938
  7. Avatar for BootsMcGraw 27. BootsMcGraw Lv 1 12 pts. 10,921
  8. Avatar for georg137 28. georg137 Lv 1 11 pts. 10,787
  9. Avatar for matt61ger 29. matt61ger Lv 1 10 pts. 10,768
  10. Avatar for heather-1 30. heather-1 Lv 1 9 pts. 10,760

Comments