Icon representing a puzzle

2452: CASP16 Ligand Puzzle L1000

Closed since almost 2 years ago

Intermediate Overall Small Molecule Design

Summary


Created
May 03, 2024
Expires
Max points
100
Description

Use the Ligand Queue (default hotkey 7) to explore how different ligand bind to the protein.

This puzzle is part of the CASP16 competition. Foldit players are participating to see how well they can predict how small molecules can bind to proteins. Note that in contrast to prior drug design puzzles, we're not just interested in the top scoring small molecule, but instead are interested in getting good structures for each of the provided ligand compounds. Its worth dividing your time across all the compounds, rather than concentrating on a particular one.

The protein target is the Human Chymase protease There are a number of structures of chymase bound to ligands at the PDB. There are 17 ligand structures of interest in this competition. The starting small molecule is from a known crystal structure, and is provided just to indicate the likely binding site. It's not one of the molecules in the competition - you'll need to use the Ligand Queue tool in order to load one of the other ligands.

Since the goal is to predict the structure of the protein ligand complex, we've allowed full backbone and sidechain flexibility on this puzzle. -- That said, all of the bound structures are highly similar to each other (and thus to the starting structure). The backbone is very unlikely to change at all from the starting conformation.

Sequence
MLLLPLPLLLFLLCSRAEAGEIIGGTESKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGRSITVTLGAHNITEEEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKASLTLAVGTLPFPSQKNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN

Top groups


  1. Avatar for Contenders 100 pts. 22,320
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 20,903
  3. Avatar for Go Science 3. Go Science 33 pts. 20,634
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 20,622
  5. Avatar for VeFold 5. VeFold 8 pts. 20,285
  6. Avatar for Australia 6. Australia 4 pts. 18,795
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 18,088
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 17,649
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 17,269
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 17,162

  1. Avatar for nicrach 61. nicrach Lv 1 1 pt. 16,715
  2. Avatar for Trajan464 62. Trajan464 Lv 1 1 pt. 16,711
  3. Avatar for Karlheinz 63. Karlheinz Lv 1 1 pt. 16,704
  4. Avatar for furi0us 64. furi0us Lv 1 1 pt. 16,589
  5. Avatar for Alistair69 65. Alistair69 Lv 1 1 pt. 16,588
  6. Avatar for deathbat_87 66. deathbat_87 Lv 1 1 pt. 16,482
  7. Avatar for Kimdonghyeon 67. Kimdonghyeon Lv 1 1 pt. 16,069
  8. Avatar for Swapper242 68. Swapper242 Lv 1 1 pt. 15,650
  9. Avatar for Zleeb 69. Zleeb Lv 1 1 pt. 15,606
  10. Avatar for rmoretti 70. rmoretti Lv 1 1 pt. 15,481

Comments


rmoretti Staff Lv 1

@BootsMcGraw But if my modified small molecule scores better than its original form, wouldn't it be a better candidate as a ligand than the original?

Quite possibly. However in CASP (in contrast to CACHE), there's no compound synthesis or testing. The compounds for which there's experimental data are pre-determined before the competition began. Only those compounds are relevant for the puzzle.

rmoretti Staff Lv 1

@HuubR I was somewhat surprised to find that it is still possible to use the Small Molecule Design panel.

I'm surprised as well. I thought we fixed that bug. But apparently it's just fixed for switching puzzles while the client is open, not close-the-client and reopen. – Thanks for the reproducibility case. We'll take a look at it.

which, by the way, doesn't have a puzzle number

Oops. That should be corrected now. Thanks.

HuubR Lv 1

Assuming that there will be a next round to this puzzle, would it be an idea to include a bonus for using one of the 17 ligands (like the +4000 point Compound Library objective in Puzzles 2363 and 2366), but with a different value for each of those 17 ligands?
I think this could solve two problems:

  • Even if the bug could be fixed in time, there would still be players who haven't updated their clients yet, and who can therefore modify the ligands.
  • By making the bonus different for each of the 17 ligands, you could draw extra attention to those ligands that didn't score well in the preceding round(s).
    You might call this the Ligand Handicap objective. Just like a golf handicap, it would help to create a level playing field. Unlike in golf, however, it is not meant to help specific players, but rather specific ligands that would otherwise receive too little attention from us, players.

With this bonus, it would also be possible to simply enable the Small Molecule Design tool. I think it would help if we can use it, because some of the ligands only differ from each other by one or two atoms, and it is much easier to make that change with the tool than it is to use the Ligand Queue and then have to re-align and Tweak the new ligand.
I thought I might be the only one doing it this way, but @nspc just mentioned in Discord that he prefers to work this way, too.

jeff101 Lv 1

If there will be a follow-up puzzle to Puzzle 2452 with the same protein and same ligands, please let it load our results from Puzzle 2452. I know many of the results I have obtained so far in Puzzle 2452 could be improved with more time.

latin krepin Lv 1

if you want to ensure full attention to each ligand just create separate puzzles. if you have one ligand that scores well, it breaks the comparison scale: you can't compare how well your current lower-scoring ligand is scoring in regard to your other lower-scoring ligands, but worse, you can't compare it to other players' as well and that's game-breaking for me. if the final point is just having a rough idea of where the binding site is, you can even lower the duration of those puzzles (i could go for one day but two or three may be more consensual)