Icon representing a puzzle

2462: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since almost 2 years ago

Novice Overall Prediction

Summary


Created
May 21, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Go Science 100 pts. 10,657
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 56 pts. 10,610
  3. Avatar for Marvin's bunch 3. Marvin's bunch 29 pts. 10,543
  4. Avatar for Contenders 4. Contenders 14 pts. 10,407
  5. Avatar for Void Crushers 5. Void Crushers 6 pts. 10,271
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 2 pts. 10,169
  7. Avatar for Australia 7. Australia 1 pt. 10,158
  8. Avatar for VeFold 8. VeFold 1 pt. 10,095
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 10,033
  10. Avatar for BOINC@Poland 10. BOINC@Poland 1 pt. 9,011

  1. Avatar for g_b 11. g_b Lv 1 48 pts. 10,343
  2. Avatar for Galaxie 12. Galaxie Lv 1 45 pts. 10,323
  3. Avatar for dcrwheeler 13. dcrwheeler Lv 1 41 pts. 10,311
  4. Avatar for MicElephant 14. MicElephant Lv 1 38 pts. 10,293
  5. Avatar for Idiotboy 15. Idiotboy Lv 1 35 pts. 10,290
  6. Avatar for TheGUmmer 16. TheGUmmer Lv 1 32 pts. 10,271
  7. Avatar for fpc 17. fpc Lv 1 30 pts. 10,269
  8. Avatar for gmn 18. gmn Lv 1 27 pts. 10,255
  9. Avatar for silent gene 19. silent gene Lv 1 25 pts. 10,247
  10. Avatar for Punzi Baker 3 20. Punzi Baker 3 Lv 1 23 pts. 10,215

Comments